PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.003G190400.1
Common NamePHAVU_003G190400g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB
Protein Properties Length: 311aa    MW: 34674.4 Da    PI: 6.3435
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.003G190400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.31.3e-161764148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT+eEd  lv +++++G+g+W++++   g+ R+ k+c++rw +yl
  Phvul.003G190400.1 17 KGPWTPEEDIMLVSYIQEHGPGNWRSVPTNSGLIRCSKSCRLRWTNYL 64
                        79********************************************97 PP

2Myb_DNA-binding51.22.8e-1670115148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         rg++T+ E++++v++ ++lG++ W++Ia++++  Rt++++k++w+++l
  Phvul.003G190400.1  70 RGNFTEHEEKIIVHLQALLGNR-WAAIASYLP-ERTDNDIKNYWNTHL 115
                         89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.6E-23867IPR009057Homeodomain-like
PROSITE profilePS5129424.8351268IPR017930Myb domain
SuperFamilySSF466893.04E-3014111IPR009057Homeodomain-like
SMARTSM007174.5E-131666IPR001005SANT/Myb domain
PfamPF002495.5E-151764IPR001005SANT/Myb domain
CDDcd001673.34E-111964No hitNo description
Gene3DG3DSA:1.10.10.602.1E-2468120IPR009057Homeodomain-like
PROSITE profilePS5129419.84969119IPR017930Myb domain
SMARTSM007175.4E-1669117IPR001005SANT/Myb domain
PfamPF002492.1E-1470115IPR001005SANT/Myb domain
CDDcd001671.68E-1172115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MCEMGRSSCC DKIEIKKGPW TPEEDIMLVS YIQEHGPGNW RSVPTNSGLI RCSKSCRLRW  60
TNYLRPGIKR GNFTEHEEKI IVHLQALLGN RWAAIASYLP ERTDNDIKNY WNTHLKKKLK  120
LSDQSGNEEG VEQERHSSSS HPKGQWERRL QTDIQTAKQA LCDALSLHTT PATHAVPETI  180
PSSTSHPPYS QASSSYASSY ENISRLMENW MKTPSSNETN SLGGFSFSNT VNNTPRCSSS  240
EGAHSTTNTT CAQDNVFDLF TFSSSTNYGS PSQTQVPLTM IENWLFEDGS SQSQGDLMSM  300
SLEESTLGLF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-271411924128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007155313.10.0hypothetical protein PHAVU_003G190400g
SwissprotP813921e-109MYB06_ANTMA; Myb-related protein 306
TrEMBLV7CAU50.0V7CAU5_PHAVU; Uncharacterized protein
STRINGGLYMA05G01080.11e-151(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101634115
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47600.13e-97myb domain protein 94